PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025597P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 200aa    MW: 22745.1 Da    PI: 11.6575
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025597P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.37.9e-4274150278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cq+++C+adlseak+yhrrhkvCe+hska+ v+v+g++qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++a
  MELO3C025597P1  74 CQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIRQRFCQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKNSA 150
                     **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.0E-3467135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.25771148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3872151IPR004333Transcription factor, SBP-box
PfamPF031102.4E-3174147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MQRALKASII PKIRQWSMTI SNTRRRRRRL VEEEEVAIAM LAMHWVILTM RKGKRGAAVS  60
GRGKSGGSVS SPSCQAHNCA ADLSEAKRYH RRHKVCEFHS KAAIVMVAGI RQRFCQQCSR  120
FHELTEFDEA KRSCRRRLAG HNERRRKNSA ESQGESTSRK SAPQAQSKES HCRQLVEDQR  180
SRIQMAPPGS SGYKHLHIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3665147284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12328RRRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818620.0LN681862.1 Cucumis melo genomic scaffold, anchoredscaffold00081.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463797.11e-102PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ9S7582e-42SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A0A0L3D92e-99A0A0A0L3D9_CUCSA; Squamosa promoter-binding protein
STRINGPOPTR_0001s40870.19e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.25e-42squamosa promoter binding protein-like 4